Cagrilintide (Amylin Analog) (5mg) For Sale
Cagrilintide is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Cagrilintide Description
Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Synonyms | 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
Lyophilized Peptides:
Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
Cagrilintide Research
Cagrilintide is a long-acting amylin analogue developed to address the limitations of existing amylin analogues like pramlintide, which have a short half-life. Cagrilintide is designed to be more stable and is lipidated to extend its duration of action. It has shown significant potential in inducing weight loss, both as a standalone treatment and in combination with GLP-1 analogues like semaglutide.
Weight Management and Obesity Efficacy
Clinical trials have demonstrated that cagrilintide effectively reduces body weight in individuals with obesity. In a phase 2 trial, cagrilintide led to greater weight reductions compared to placebo and liraglutide, with the highest dose achieving a mean weight reduction of 10.8%1.
When combined with semaglutide, cagrilintide showed enhanced weight loss and improved glycaemic control in individuals with type 2 diabetes2. A meta-analysis of RCTs also showed that this combination (CagriSema) resulted in significantly greater weight loss compared to semaglutide alone8.
Comparative Studies
Cagrilintide has been compared to other dual amylin and calcitonin receptor agonists (DACRAs) like KBP-336. While both show efficacy in weight loss and glucose control, KBP-336 has demonstrated superior long-term efficacy in preclinical models, suggesting differences in receptor activation balance3.
Combination therapies involving cagrilintide and other agents like tirzepatide have shown promising results in enhancing weight loss and reducing food intake, highlighting the potential for combinatorial approaches in obesity management4.
Cardiovascular Health
Amylin-based therapies, including cagrilintide, are being investigated for their potential cardiovascular benefits, such as vasodilatory, anti-inflammatory, and anti-atherosclerotic effects. These therapies are scrutinized for their impact on blood pressure, lipid profiles, and cardiovascular markers. Amylin analogs may offer innovative approaches to enhance metabolic and cardiovascular health, potentially reducing the global burden of cardiovascular diseases5.
Glycemic Control
Cagrilintide controls hyperglycemia through various actions. In a phase 2 trial of obese patients with type 2 diabetes, CagriSema reduced glycated hemoglobin (HbA1c) levels. At 32 weeks, the reduction in HbA1c levels with CagriSema was statistically superior to cagrilintide alone, but not statistically greater than semaglutide6. Another study combining semaglutide and cagrilintide found that CagriSema improved glycemic control7.
Certificate of Analysis (COA) for Every Batch
A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.
Each COA reports results from third-party laboratory analysis, including:
- High-performance liquid chromatography (HPLC) for purity, typically confirmed at 99% or higher
- Liquid chromatography mass spectrometry (LC-MS) for molecular identity and mass confirmation
- Sterility and endotoxin screening where applicable
- Chemical contaminant and residual solvent checks
COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.

























Reviews
There are no reviews yet.