FOXO4-DRI (10 mg) For Sale
FOXO4-DRI is a synthetic peptide designed to selectively induce apoptosis in senescent cells, which are cells that have stopped dividing but remain metabolically active. These cells contribute to aging and various age-related diseases through their pro-inflammatory secretions, known as the senescence-associated secretory phenotype (SASP).
FOXO4-DRI Peptide Description
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids) |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358 g/mol |
| CAS Number | 2460055-10-9 |
| Synonyms | Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431 |
FOXO4-DRI Research
FOXO4-DRI represents a promising therapeutic strategy for targeting senescent cells across various diseases, including cancer, pulmonary fibrosis, and age-related conditions. By selectively inducing apoptosis in senescent cells, FOXO4-DRI can restore tissue homeostasis and improve treatment outcomes. Further research is needed to fully understand its potential and optimize its application in clinical settings.
Applications in Cancer Treatment
FOXO4-DRI has been studied for its potential to enhance the radiosensitivity of non-small cell lung cancer (NSCLC) cells. By inducing apoptosis in senescent cancer-associated fibroblasts, FOXO4-DRI can reduce radioresistance in NSCLC, making cancer cells more susceptible to radiotherapy. This approach not only targets the tumor cells but also addresses the tumor microenvironment, which plays a crucial role in cancer progression and treatment resistance.1
Role in Pulmonary Fibrosis
In models of pulmonary fibrosis, FOXO4-DRI has been shown to decrease the number of senescent cells and reduce the expression of senescence-associated secretory phenotype (SASP) factors. This results in the attenuation of fibrosis-related morphological changes and collagen deposition, suggesting that FOXO4-DRI could serve as a viable therapeutic option for treating pulmonary fibrosis.2
Impact on Age-Related Conditions
FOXO4-DRI has demonstrated potential in alleviating age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. By promoting the apoptosis of these senescent cells, FOXO4-DRI improves the testicular microenvironment and restores testosterone levels, highlighting its potential in treating male late-onset hypogonadism.3
Effects on Cartilage Regeneration
In the context of cartilage regeneration, FOXO4-DRI has been used to selectively remove senescent cells from in vitro expanded human chondrocytes. While it effectively reduces the senescence level in these cells, its impact on enhancing chondrogenic potential and cartilage formation requires further investigation.4
Certificate of Analysis (COA) for Every Batch
A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.
Each COA reports results from third-party laboratory analysis, including:
- High-performance liquid chromatography (HPLC) for purity, typically confirmed at 99% or higher
- Liquid chromatography mass spectrometry (LC-MS) for molecular identity and mass confirmation
- Sterility and endotoxin screening where applicable
- Chemical contaminant and residual solvent checks
COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.

















Reviews
There are no reviews yet.